Artículos de revistas
Purification And N-terminal Sequencing Of Two Presynaptic Neurotoxic Pla2, Neuwieditoxin-i And Neuwieditoxin-ii, From Bothrops Neuwiedi Pauloensis (jararaca Pintada) Venom
Registro en:
Journal Of Venomous Animals And Toxins Including Tropical Diseases. , v. 13, n. 1, p. 103 - 121, 2007.
16789199
10.1590/S1678-91992007000100008
2-s2.0-34047213358
Autor
Borja-Oliveira C.R.
Kassab B.H.
Soares A.M.
Toyama M.H.
Giglio J.R.
Marangoni S.
Re L.
Rodrigues-Simioni L.
Institución
Resumen
Two presynaptic phospholipases A2 (PLA2), neuwieditoxin-I (NeuTX-I) and neuwieditoxin-II (NeuTX-II), were isolated from the venom of Bothrops neuwiedi pauloensis (BNP). The venom was fractionated using molecular exclusion HPLC (Protein-Pak 300SW column), followed by reverse phase HPLC (μBondapak C18 column). Tricine-SDS-PAGE in the presence or absence of dithiothreitol showed that NeuTX-I and NeuTX-II had a molecular mass of approximately 14 kDa and 28kDa, respectively. At 10μg/ml, both toxins produced complete neuromuscular blockade in indirectly stimulated chick biventer cervicis isolated preparation without inhibiting the response to acetylcholine, but NeuTX-II reduced the response to KCl by 67.0±8.0% (n=3; p<0.05). NeuTX-I and NeuTX-II are probably responsible for the presynaptic neurotoxicity of BNP venom in vitro. In fact, using loose patch clamp technique for mouse phrenic nerve-diaphragm preparation, NeuTX-I produced a calcium-dependent blockade of acetylcholine release and caused appearance of giant miniature end-plate potentials (mepps), indicating a pure presynaptic action. The N-terminal sequence of NeuTX-I was DLVQFGQMILKVAGRSLPKSYGAYGCYCGWGGRGK (71% homology with bothropstoxin-II and 54% homology with caudoxin) and that of NeuTX-II was SLFEFAKMILEETKRLPFPYYGAYGCYCGWGGQGQPKDAT (92% homology with Basp-III and 62% homology with crotoxin PLA2). The fact that NeuTX-I has Q-4 (Gln-4) and both toxins have F-5 (Phe-5) and Y-28 (Tyr-28) strongly suggests that NeuTX-I and NeuTX-II are Asp49 PLA2. 13 1 103 121 AIRD, S.D., KAISER II, LEWIS RV., KRUGGEL WG. A complete amino acid sequence for the basic subunit of crotoxin (1986) Arch. Biochem. Biophys, 249, pp. 296-300 AIRD, S.D., KRUGGEL, W.G., KAISER II, Amino acid sequence of the basic subunit of Mojave toxin from the venom of the Mojave rattlesnake (Crotalus s. scutulatus) (1990) Toxicon, 28, pp. 669-673 BEGHINI, D.G., TOYAMA, M.H., HYSLOP, S., SODEK, L., NOVELLO, J.C., MARANGONI, S., Enzymatic characterization of a novel phospholipase A2 from Crotalus durissus cascavella rattlesnake (maracambóia) venom (2000) J. Protein Chem, 19, pp. 603-607 BORJA-OLIVEIRA, C.R., DURIGON, A.M., VALLIN, A.C.C., TOYAMA, M.H., SOUCCAR, C., MARANGONI, S., RODRIGUES-SIMIONI, L., The pharmacological effects of Bothrops neuwiedi pauloensis (jararaca-pintada) snake venom on avian neuromuscular transmission (2003) Braz. J. Med. Biol. Res, 36, pp. 617-624 BORJA-OLIVEIRA, C.R., SOARES, A.M., ZAMUNER, S.R., HYSLOP, S., GIGLIO, J.R., PRADO-FRANCESCHI, J., RODRIGUES-SIMIONI, L., Intraspecific variation in the neurotoxic and myotoxic activities of Bothrops neuwiedi snake venoms (2002) J. Venom. Anim. Toxins, 8, pp. 88-101 BUCARETCHI, F., HERRERA, S.R.F., HYSLOP, S., BARACAT, E.C.E., VIEIRA, R.J., Snakebites by Bothrops spp in children in Campinas, São Paulo, Brazil (2001) Rev. Inst. Med. Trop. São Paulo, 43, pp. 329-333 CHO, W., KEZDY, F.J., Chromogenic substrate and assay of phospholipase A 2 (1991) Meth. Enzymol, 197, pp. 75-79 CINTRA, A.C., MARANGONI, S., OLIVEIRA, B., GIGLIO, J.R., Bothropstoxin-I: Amino acid sequence and function (1993) J. Protein Chem, 12, pp. 57-64 COGO, J.C., PRADO-FRANCESCHI, J., CRUZ-HÖFLING, M.A., CORRADO, A.P., RODRIGUES-SIMIONI, L., Effects of Bothrops insularis on the mouse and chick nerve-muscle preparation (1993) Toxicon, 31, pp. 1237-1247 COGO, J.C., PRADO-FRANCESCHI, J., GIGLIO, J.R., CORRADO, A.P., CRUZ-HÖFLING, M.A., DONATO, J.L., LEITE, G.B., RODRIGUES-SIMIONI, L., An unusual presynaptic action of Bothrops insularis snake venom mediated by phospholipase A2 fraction (1998) Toxicon, 36, pp. 1323-1332 DE SOUSA, M.V., MORHY, L., ARNI, R.K., WARD, R.J., GUTIÉRREZ, J.M., Amino acid sequence of a myotoxic Lys-49-phospholipase A2 homologue from the venom of Cerrophidion (Bothrops) godmani (1998) Biochim. Biophys. Acta, 1384, pp. 204-208 DURIGON, A.M., BORJA-OLIVEIRA, C.R., DAL, B.C., OSHIMA-FRANCO, Y., COGO, J.C., LAPA, A.J., SOUCCAR, C., RODRIGUES-SIMIONI, L., Neuromuscular activity of Bothrops neuwiedi pauloensis snake venom in mouse nerve-muscle preparations (2005) J. Venom. Anim. Toxins incl. Trop. Dis, 11, pp. 22-33 FONTES, M.R., SOARES, A.M., RODRIGUES, V.M., FERNANDES, A.C., DA SILVA, R.J., GIGLIO, J.R., Crystallization and preliminary X-ray diffraction analysis of a myotoxic phospholipase A(2) homologue from Bothrops neuwiedi pauloensis venom (1999) Biochim. Biophys. Acta, 1432, pp. 393-395 FRANCIS, B., GUTIERREZ, J.M., LOMONTE, B., KAISER II, Myotoxin II from Bothrops asper (Terciopelo) venom is a lysine-49 phospholipase A 2 (1991) Arch. Biochem. Biophys, 284, pp. 352-359 GEOGHEGAN, P., ANGULO, Y., CANGELOSI, A., DIAZ, M., LOMONTE, B., Characterization of a basic phospholipase A2-homologue myotoxin isolated from the venom of the snake Bothrops neuwiedii (yarara chica) from Argentina (1999) Toxicon, 37, pp. 1735-1746 GINSBORG, B.L., WARRINER, J., The isolated chick biventer cervicis nerve-muscle preparation (1960) Brit. J. Pharmacol, 15, pp. 410-411 HALPERT, J., EAKER, D., Amino acid sequence of a presynaptic neurotoxin from the venom of Notechis scutatus scutatus (Australian tiger snake) (1975) J. Biol. Chem, 250, pp. 6990-6997 HARVEY AL., BARFARAZ A., THOMPSON E., FAIZ A., PRESTON S., HARRIS JB. Screening of snake venoms for neurotoxic and myotoxic effects using simple in vitro preparations from rodents and chicks. Toxicon, 1994, 32, 257-65HELUANY, N.F., HOMSI-BRANDEBURGO, M.I., GIGLIO, J.R., PRADO-FRANCESCHI, J., RODRIGUES-SIMIONI, L., Effects induced by bothropstoxin, a component from Bothrops jararacussu snake venom, on mouse and chick muscle preparations (1992) Toxicon, 30, pp. 1203-1210 HOLZER, M., MACKESSY, S.P., An aqueous endpoint assay of snake venom phospholipase A2 (1995) Toxicon, 35, pp. 1149-1155 HOMSI-BRANDEBURGO, M.I., QUEIROZ, L.S., SANTO-NETO, H., RODRIGUES-SIMIONI, L., GIGLIO, J.R., Fractionation of Bothrops jararacussu snake venom: Partial chemical characterization and biological activity of bothropstoxin (1988) Toxicon, 26, pp. 615-627 JOHNSON, E.K., OWNBY, C.L., Isolation of a myotoxin from the venom of Agkistrodon contortrix laticinctus (broad-banded copperhead) and pathogenesis of myonecrosis induced by it in mice (1993) Toxicon, 31, pp. 243-255 KAISER II, Gutierrez, J.M., Plummer, D., Aird, S.D., Odell, G.V., AIRD SD., ODELL GV. The amino acid sequence of a myotoxic phospholipase from the venom of Bothrops asper (1990) Arch. Biochem. Biophys, 278, pp. 319-325 KATZ, B., MILEDI, R., The binding of acetylcholine to receptors and its removal from the synaptic cleft (1973) J. Physiol, 231, pp. 549-574 KINI RM. Phospholipase A2 - A complex multifunctional protein puzzle. In: KINI RM. Ed., Venom phosholipase A2 enzymes. Structure, function and mechanism. New York: John Wiley & Sons Inc Chichester, 1997, 1-28KONDO, K., NARITA, K., LEE, C.Y., Amino acid sequences of the two polypeptide chains in beta1-bungarotoxin from the venom of Bungarus multicinctus (1978) J. Biochem, 83, pp. 101-115 KONDO, K., TODA, H., NARITA, K., LEE, C.Y., Amino acid sequence of β2-bungarotoxin from Bungarus multicinctus venom: The amino acid substitutions in the B chains (1982) J. Biochem, 91, pp. 1519-1530 KONDO, K., ZHANG, J., XU, K., KAGAMIYAMA, H., Amino acid sequence of a presynaptic neurotoxin, agkistrodotoxin, from the venom of Agkistrodon halys pallas (1989) J. Biochem, 105, pp. 196-203 KORDAS, M., On the role of junctional cholinesterase in determining the time course of the end-plate current (1977) J. Physiol, 270, pp. 133-150 LEE, C.Y., HO, C.L., BOTES, D.P., Site of action of caudoxin, a neurotoxic phospholipase A2 from the horned puff adder (Bitis caudalis) venom (1982) Toxicon, 20, pp. 637-647 LIND, P., EAKER, D., Amino-acid sequence of the alpha-subunit of taipoxin, an extremely potent presynaptic neurotoxin from the Australian snake taipan (Oxyuranus s. scutellatus) (1982) European J. Biochem, 124, pp. 441-447 MAGRO, A.J., SOARES, A.M., GIGLIO, J.R., FONTES, M.R., Crystal structures of BnSP-7 and BnSP-6, two Lys49 phospholipases A2: Quartenary structure and inhibition mechanism insights (2003) Biochem. Biophys. Res. Commun, 311, pp. 713-720 MONTECUCCO, C., ROSSETTO, O., How do presynaptic PLA2 neurotoxins block nerve terminals? (2000) Trends Biochem. Sciences, 25, pp. 266-270 OSHIMA-FRANCO, Y., HYSLOP, S., CINTRA, A.C., GIGLIO, J.R., DA CRUZ-HOFLING, M.A., RODRIGUES-SIMIONI, L., Neutralizing capacity of commercial bothropic antivenom against Bothrops jararacussu venom and bothropstoxin-I (2000) Muscle Nerve, 23, pp. 1832-1839 OSHIMA-FRANCO, Y., LEITE, G.B., SILVA, G.H., CARDOSO, D.F., HYSLOP, S., GIGLIO, J.R., DA CRUZ-HOFLING, M.A., RODRIGUES-SIMIONI, L., Neutralization of the pharmacological effects of bothropstoxin-I from Bothrops jararacussu (jararacuçu) venom by crotoxin antiserum and heparin (2001) Toxicon, 39, pp. 1477-1485 PEREIRA, M.F., NOVELLO, J.C., CINTRA, A.C., GIGLIO, J.R., LANDUCCI, E.T., OLIVEIRA, B., MARANGONI, S., The amino acid sequence of bothropstoxin-II, an Asp-49 myotoxin from Bothrops jararacussu (jararacuçu) venom with low phospholipase A2 activity (1998) J. Protein Chem, 17, pp. 381-386 RE, L., BAROCCI, S., CAPITANI, C., VIVANI, C., RICCI, M., RINALDI, L., PAOLUCCI, G., MORALES, M.A., Effects of some natural extracts on the acetylcholine release at the mouse neuromuscular junction (1999) Pharmacol. Res, 39, pp. 239-245 RE, L., COLA, V., FULGENZI, G., MARINELLI, F., CONCETTONI, C., ROSSINI, L., Postsynaptic effects of methoctramine at the mouse neuromuscular junction (1993) Neuroscience, 57, pp. 451-457 RE, L., GIUSTI, P., CONCETTONI, C., DI SARRA, B., Computerized estimation of spontaneous and evoked acetylcholine release at the neuromuscular junction (1989) J. Pharmacol. Meth, 22, pp. 233-242 RE, L., MORETTI, V., ROSSINI, L., GIUSTI, P., Sodium-activated potassium current in mouse diaphragm (1990) FEBS Lett, 270, pp. 195-197 RIBEIRO, L.A., ALBUQUERQUE, M.J., PIRES DE CAMPOS VAF., KATZ G., TAKAOKAM NY., LEBRÃO ML., JORGE MT. Óbitos por serpentes peçonhentas no Estado de São Paulo: Avaliação de 43 casos, 1988/98 (1998) Rev. Assoc. Méd. Bras, 44, pp. 312-318 RITONJA A., GUBENSEK F. Ammodytoxin A, a highly lethal phospholipase A2 from Vipera ammodytes ammodytes venom. Biochim. Biophys. Acta, 1985, 828, 306-12RODRIGUES-SIMIONI, L., BORGESE, N., CECCARELLI, B., The effects of Bothrops jararacussu venom and its components on frog nerve-muscle preparation (1983) Neuroscience, 10, pp. 475-489 RODRIGUES-SIMIONI, L., ZAMUNER, S.R., COGO, J.C., BORJA-OLIVEIRA, C.R., PRADO-FRANCESCHI, J., CRUZ-HOFLING, M.A., CORRADO, A.P., Pharmacological evidence for a presynaptic action of venoms from Bothrops insularis (jararaca ilhoa) and Bothrops neuwiedi (jararaca pintada) (2004) Toxicon, 43, pp. 633-638 SCHAGGER, H., VON JAGOW, G., Tricine-sodium dodecyl sulfate-polyacrylamide gel electrophoresis for the separation of proteins in the range from 1 to 100kDa (1987) Anal. Biochem, 166, pp. 368-379 SOARES, A.M., GUERRA-SÁ, R., BORJA-OLIVEIRA, C.R., RODRIGUES, V.M., RODRIGUES-SIMIONI, L., RODRIGUES, V., FONTES, M.R.M., GIGLIO, J.R., Structural and functional characterization of BnSP-7, a Lys49 myotoxic phospholipase A2 homologue from Bothrops neuwiedi venom (2000) Arch. Biochem. Biophys, 378, pp. 201-209 STÜHMER, W., ROBERTS, W.M., ALMERS, W., The loose patch clamp (1983) Single Channel Recording, p. 123. , SAKMANN B AND NEHER E, Eds, Plenum Press, New York; TOYAMA, M.H., SOARES, A.M., WEN-HWA, L., POLIKARPOV, I., GIGLIO, J.R., MARANGONI, S., Amino acid sequence of piratoxin-II, a myotoxic lys49 phospholipase A 2 homologue from Bothrops pirajai venom (2000) Biochimie, 82, pp. 245-250 TSAI, I.H., LU, P.J., WANG, Y.M., HO, C.L., LIAW, L.L., Molecular cloning and characterization of a neurotoxic phospholipase A2 from the venom of Taiwan habu (Trimeresurus mucrosquamatus) (1995) Biochem. J, 311, pp. 895-900 VAN DEN BERGH, C.J., SLOTBOOM, A.J., VERHEIJ, H.M., DE HAAS, G.H., The role of aspartic acid-49 in the active site of phospholipase A2. A site-specific mutagenesis study of porcine pancreatic phospholipase A 2 and the rationale of the enzymatic activity of Lys-49 phospholipase A2 from Agkistrodon piscivorus piscivorus venom (1988) European J. Biochem, 176, pp. 353-357 VAN DEENEN LL, D.H.G., The substrate specificity of phospholipases A2 (1963) Biochim. Biophys. Acta, 70, pp. 538-553 VILJOEN, C.C., BOTES, D.P., KRUGER, H., Isolation and amino acid sequence of caudoxin, a presynaptic acting toxic phospholipase A2 from the venom of the horned puff adder (Bitis caudalis) (1982) Toxicon, 20, pp. 715-737 ZAMUNER, S.R., PRADO-FRANCESCHI, J., RODRIGUES-SIMIONI, L., The screening of Bothrops venoms for neurotoxic activity using the chick biventer cervicis preparation (1996) Toxicon, 34, pp. 314-315