Purification And N-terminal Sequencing Of Two Presynaptic Neurotoxic Pla2, Neuwieditoxin-i And Neuwieditoxin-ii, From Bothrops Neuwiedi Pauloensis (jararaca Pintada) Venom

dc.creatorBorja-Oliveira C.R.
dc.creatorKassab B.H.
dc.creatorSoares A.M.
dc.creatorToyama M.H.
dc.creatorGiglio J.R.
dc.creatorMarangoni S.
dc.creatorRe L.
dc.creatorRodrigues-Simioni L.
dc.date2007
dc.date2015-06-30T18:52:30Z
dc.date2015-11-26T14:39:11Z
dc.date2015-06-30T18:52:30Z
dc.date2015-11-26T14:39:11Z
dc.date.accessioned2018-03-28T21:44:41Z
dc.date.available2018-03-28T21:44:41Z
dc.identifier
dc.identifierJournal Of Venomous Animals And Toxins Including Tropical Diseases. , v. 13, n. 1, p. 103 - 121, 2007.
dc.identifier16789199
dc.identifier10.1590/S1678-91992007000100008
dc.identifierhttp://www.scopus.com/inward/record.url?eid=2-s2.0-34047213358&partnerID=40&md5=93fa8b9a335a3a3f13a48d59344f480d
dc.identifierhttp://www.repositorio.unicamp.br/handle/REPOSIP/105194
dc.identifierhttp://repositorio.unicamp.br/jspui/handle/REPOSIP/105194
dc.identifier2-s2.0-34047213358
dc.identifier.urihttp://repositorioslatinoamericanos.uchile.cl/handle/2250/1249891
dc.descriptionTwo presynaptic phospholipases A2 (PLA2), neuwieditoxin-I (NeuTX-I) and neuwieditoxin-II (NeuTX-II), were isolated from the venom of Bothrops neuwiedi pauloensis (BNP). The venom was fractionated using molecular exclusion HPLC (Protein-Pak 300SW column), followed by reverse phase HPLC (μBondapak C18 column). Tricine-SDS-PAGE in the presence or absence of dithiothreitol showed that NeuTX-I and NeuTX-II had a molecular mass of approximately 14 kDa and 28kDa, respectively. At 10μg/ml, both toxins produced complete neuromuscular blockade in indirectly stimulated chick biventer cervicis isolated preparation without inhibiting the response to acetylcholine, but NeuTX-II reduced the response to KCl by 67.0±8.0% (n=3; p<0.05). NeuTX-I and NeuTX-II are probably responsible for the presynaptic neurotoxicity of BNP venom in vitro. In fact, using loose patch clamp technique for mouse phrenic nerve-diaphragm preparation, NeuTX-I produced a calcium-dependent blockade of acetylcholine release and caused appearance of giant miniature end-plate potentials (mepps), indicating a pure presynaptic action. The N-terminal sequence of NeuTX-I was DLVQFGQMILKVAGRSLPKSYGAYGCYCGWGGRGK (71% homology with bothropstoxin-II and 54% homology with caudoxin) and that of NeuTX-II was SLFEFAKMILEETKRLPFPYYGAYGCYCGWGGQGQPKDAT (92% homology with Basp-III and 62% homology with crotoxin PLA2). The fact that NeuTX-I has Q-4 (Gln-4) and both toxins have F-5 (Phe-5) and Y-28 (Tyr-28) strongly suggests that NeuTX-I and NeuTX-II are Asp49 PLA2.
dc.description13
dc.description1
dc.description103
dc.description121
dc.descriptionAIRD, S.D., KAISER II, LEWIS RV., KRUGGEL WG. A complete amino acid sequence for the basic subunit of crotoxin (1986) Arch. Biochem. Biophys, 249, pp. 296-300
dc.descriptionAIRD, S.D., KRUGGEL, W.G., KAISER II, Amino acid sequence of the basic subunit of Mojave toxin from the venom of the Mojave rattlesnake (Crotalus s. scutulatus) (1990) Toxicon, 28, pp. 669-673
dc.descriptionBEGHINI, D.G., TOYAMA, M.H., HYSLOP, S., SODEK, L., NOVELLO, J.C., MARANGONI, S., Enzymatic characterization of a novel phospholipase A2 from Crotalus durissus cascavella rattlesnake (maracambóia) venom (2000) J. Protein Chem, 19, pp. 603-607
dc.descriptionBORJA-OLIVEIRA, C.R., DURIGON, A.M., VALLIN, A.C.C., TOYAMA, M.H., SOUCCAR, C., MARANGONI, S., RODRIGUES-SIMIONI, L., The pharmacological effects of Bothrops neuwiedi pauloensis (jararaca-pintada) snake venom on avian neuromuscular transmission (2003) Braz. J. Med. Biol. Res, 36, pp. 617-624
dc.descriptionBORJA-OLIVEIRA, C.R., SOARES, A.M., ZAMUNER, S.R., HYSLOP, S., GIGLIO, J.R., PRADO-FRANCESCHI, J., RODRIGUES-SIMIONI, L., Intraspecific variation in the neurotoxic and myotoxic activities of Bothrops neuwiedi snake venoms (2002) J. Venom. Anim. Toxins, 8, pp. 88-101
dc.descriptionBUCARETCHI, F., HERRERA, S.R.F., HYSLOP, S., BARACAT, E.C.E., VIEIRA, R.J., Snakebites by Bothrops spp in children in Campinas, São Paulo, Brazil (2001) Rev. Inst. Med. Trop. São Paulo, 43, pp. 329-333
dc.descriptionCHO, W., KEZDY, F.J., Chromogenic substrate and assay of phospholipase A 2 (1991) Meth. Enzymol, 197, pp. 75-79
dc.descriptionCINTRA, A.C., MARANGONI, S., OLIVEIRA, B., GIGLIO, J.R., Bothropstoxin-I: Amino acid sequence and function (1993) J. Protein Chem, 12, pp. 57-64
dc.descriptionCOGO, J.C., PRADO-FRANCESCHI, J., CRUZ-HÖFLING, M.A., CORRADO, A.P., RODRIGUES-SIMIONI, L., Effects of Bothrops insularis on the mouse and chick nerve-muscle preparation (1993) Toxicon, 31, pp. 1237-1247
dc.descriptionCOGO, J.C., PRADO-FRANCESCHI, J., GIGLIO, J.R., CORRADO, A.P., CRUZ-HÖFLING, M.A., DONATO, J.L., LEITE, G.B., RODRIGUES-SIMIONI, L., An unusual presynaptic action of Bothrops insularis snake venom mediated by phospholipase A2 fraction (1998) Toxicon, 36, pp. 1323-1332
dc.descriptionDE SOUSA, M.V., MORHY, L., ARNI, R.K., WARD, R.J., GUTIÉRREZ, J.M., Amino acid sequence of a myotoxic Lys-49-phospholipase A2 homologue from the venom of Cerrophidion (Bothrops) godmani (1998) Biochim. Biophys. Acta, 1384, pp. 204-208
dc.descriptionDURIGON, A.M., BORJA-OLIVEIRA, C.R., DAL, B.C., OSHIMA-FRANCO, Y., COGO, J.C., LAPA, A.J., SOUCCAR, C., RODRIGUES-SIMIONI, L., Neuromuscular activity of Bothrops neuwiedi pauloensis snake venom in mouse nerve-muscle preparations (2005) J. Venom. Anim. Toxins incl. Trop. Dis, 11, pp. 22-33
dc.descriptionFONTES, M.R., SOARES, A.M., RODRIGUES, V.M., FERNANDES, A.C., DA SILVA, R.J., GIGLIO, J.R., Crystallization and preliminary X-ray diffraction analysis of a myotoxic phospholipase A(2) homologue from Bothrops neuwiedi pauloensis venom (1999) Biochim. Biophys. Acta, 1432, pp. 393-395
dc.descriptionFRANCIS, B., GUTIERREZ, J.M., LOMONTE, B., KAISER II, Myotoxin II from Bothrops asper (Terciopelo) venom is a lysine-49 phospholipase A 2 (1991) Arch. Biochem. Biophys, 284, pp. 352-359
dc.descriptionGEOGHEGAN, P., ANGULO, Y., CANGELOSI, A., DIAZ, M., LOMONTE, B., Characterization of a basic phospholipase A2-homologue myotoxin isolated from the venom of the snake Bothrops neuwiedii (yarara chica) from Argentina (1999) Toxicon, 37, pp. 1735-1746
dc.descriptionGINSBORG, B.L., WARRINER, J., The isolated chick biventer cervicis nerve-muscle preparation (1960) Brit. J. Pharmacol, 15, pp. 410-411
dc.descriptionHALPERT, J., EAKER, D., Amino acid sequence of a presynaptic neurotoxin from the venom of Notechis scutatus scutatus (Australian tiger snake) (1975) J. Biol. Chem, 250, pp. 6990-6997
dc.descriptionHARVEY AL., BARFARAZ A., THOMPSON E., FAIZ A., PRESTON S., HARRIS JB. Screening of snake venoms for neurotoxic and myotoxic effects using simple in vitro preparations from rodents and chicks. Toxicon, 1994, 32, 257-65HELUANY, N.F., HOMSI-BRANDEBURGO, M.I., GIGLIO, J.R., PRADO-FRANCESCHI, J., RODRIGUES-SIMIONI, L., Effects induced by bothropstoxin, a component from Bothrops jararacussu snake venom, on mouse and chick muscle preparations (1992) Toxicon, 30, pp. 1203-1210
dc.descriptionHOLZER, M., MACKESSY, S.P., An aqueous endpoint assay of snake venom phospholipase A2 (1995) Toxicon, 35, pp. 1149-1155
dc.descriptionHOMSI-BRANDEBURGO, M.I., QUEIROZ, L.S., SANTO-NETO, H., RODRIGUES-SIMIONI, L., GIGLIO, J.R., Fractionation of Bothrops jararacussu snake venom: Partial chemical characterization and biological activity of bothropstoxin (1988) Toxicon, 26, pp. 615-627
dc.descriptionJOHNSON, E.K., OWNBY, C.L., Isolation of a myotoxin from the venom of Agkistrodon contortrix laticinctus (broad-banded copperhead) and pathogenesis of myonecrosis induced by it in mice (1993) Toxicon, 31, pp. 243-255
dc.descriptionKAISER II, Gutierrez, J.M., Plummer, D., Aird, S.D., Odell, G.V., AIRD SD., ODELL GV. The amino acid sequence of a myotoxic phospholipase from the venom of Bothrops asper (1990) Arch. Biochem. Biophys, 278, pp. 319-325
dc.descriptionKATZ, B., MILEDI, R., The binding of acetylcholine to receptors and its removal from the synaptic cleft (1973) J. Physiol, 231, pp. 549-574
dc.descriptionKINI RM. Phospholipase A2 - A complex multifunctional protein puzzle. In: KINI RM. Ed., Venom phosholipase A2 enzymes. Structure, function and mechanism. New York: John Wiley &amp
dc.descriptionSons Inc Chichester, 1997, 1-28KONDO, K., NARITA, K., LEE, C.Y., Amino acid sequences of the two polypeptide chains in beta1-bungarotoxin from the venom of Bungarus multicinctus (1978) J. Biochem, 83, pp. 101-115
dc.descriptionKONDO, K., TODA, H., NARITA, K., LEE, C.Y., Amino acid sequence of β2-bungarotoxin from Bungarus multicinctus venom: The amino acid substitutions in the B chains (1982) J. Biochem, 91, pp. 1519-1530
dc.descriptionKONDO, K., ZHANG, J., XU, K., KAGAMIYAMA, H., Amino acid sequence of a presynaptic neurotoxin, agkistrodotoxin, from the venom of Agkistrodon halys pallas (1989) J. Biochem, 105, pp. 196-203
dc.descriptionKORDAS, M., On the role of junctional cholinesterase in determining the time course of the end-plate current (1977) J. Physiol, 270, pp. 133-150
dc.descriptionLEE, C.Y., HO, C.L., BOTES, D.P., Site of action of caudoxin, a neurotoxic phospholipase A2 from the horned puff adder (Bitis caudalis) venom (1982) Toxicon, 20, pp. 637-647
dc.descriptionLIND, P., EAKER, D., Amino-acid sequence of the alpha-subunit of taipoxin, an extremely potent presynaptic neurotoxin from the Australian snake taipan (Oxyuranus s. scutellatus) (1982) European J. Biochem, 124, pp. 441-447
dc.descriptionMAGRO, A.J., SOARES, A.M., GIGLIO, J.R., FONTES, M.R., Crystal structures of BnSP-7 and BnSP-6, two Lys49 phospholipases A2: Quartenary structure and inhibition mechanism insights (2003) Biochem. Biophys. Res. Commun, 311, pp. 713-720
dc.descriptionMONTECUCCO, C., ROSSETTO, O., How do presynaptic PLA2 neurotoxins block nerve terminals? (2000) Trends Biochem. Sciences, 25, pp. 266-270
dc.descriptionOSHIMA-FRANCO, Y., HYSLOP, S., CINTRA, A.C., GIGLIO, J.R., DA CRUZ-HOFLING, M.A., RODRIGUES-SIMIONI, L., Neutralizing capacity of commercial bothropic antivenom against Bothrops jararacussu venom and bothropstoxin-I (2000) Muscle Nerve, 23, pp. 1832-1839
dc.descriptionOSHIMA-FRANCO, Y., LEITE, G.B., SILVA, G.H., CARDOSO, D.F., HYSLOP, S., GIGLIO, J.R., DA CRUZ-HOFLING, M.A., RODRIGUES-SIMIONI, L., Neutralization of the pharmacological effects of bothropstoxin-I from Bothrops jararacussu (jararacuçu) venom by crotoxin antiserum and heparin (2001) Toxicon, 39, pp. 1477-1485
dc.descriptionPEREIRA, M.F., NOVELLO, J.C., CINTRA, A.C., GIGLIO, J.R., LANDUCCI, E.T., OLIVEIRA, B., MARANGONI, S., The amino acid sequence of bothropstoxin-II, an Asp-49 myotoxin from Bothrops jararacussu (jararacuçu) venom with low phospholipase A2 activity (1998) J. Protein Chem, 17, pp. 381-386
dc.descriptionRE, L., BAROCCI, S., CAPITANI, C., VIVANI, C., RICCI, M., RINALDI, L., PAOLUCCI, G., MORALES, M.A., Effects of some natural extracts on the acetylcholine release at the mouse neuromuscular junction (1999) Pharmacol. Res, 39, pp. 239-245
dc.descriptionRE, L., COLA, V., FULGENZI, G., MARINELLI, F., CONCETTONI, C., ROSSINI, L., Postsynaptic effects of methoctramine at the mouse neuromuscular junction (1993) Neuroscience, 57, pp. 451-457
dc.descriptionRE, L., GIUSTI, P., CONCETTONI, C., DI SARRA, B., Computerized estimation of spontaneous and evoked acetylcholine release at the neuromuscular junction (1989) J. Pharmacol. Meth, 22, pp. 233-242
dc.descriptionRE, L., MORETTI, V., ROSSINI, L., GIUSTI, P., Sodium-activated potassium current in mouse diaphragm (1990) FEBS Lett, 270, pp. 195-197
dc.descriptionRIBEIRO, L.A., ALBUQUERQUE, M.J., PIRES DE CAMPOS VAF., KATZ G., TAKAOKAM NY., LEBRÃO ML., JORGE MT. Óbitos por serpentes peçonhentas no Estado de São Paulo: Avaliação de 43 casos, 1988/98 (1998) Rev. Assoc. Méd. Bras, 44, pp. 312-318
dc.descriptionRITONJA A., GUBENSEK F. Ammodytoxin A, a highly lethal phospholipase A2 from Vipera ammodytes ammodytes venom. Biochim. Biophys. Acta, 1985, 828, 306-12RODRIGUES-SIMIONI, L., BORGESE, N., CECCARELLI, B., The effects of Bothrops jararacussu venom and its components on frog nerve-muscle preparation (1983) Neuroscience, 10, pp. 475-489
dc.descriptionRODRIGUES-SIMIONI, L., ZAMUNER, S.R., COGO, J.C., BORJA-OLIVEIRA, C.R., PRADO-FRANCESCHI, J., CRUZ-HOFLING, M.A., CORRADO, A.P., Pharmacological evidence for a presynaptic action of venoms from Bothrops insularis (jararaca ilhoa) and Bothrops neuwiedi (jararaca pintada) (2004) Toxicon, 43, pp. 633-638
dc.descriptionSCHAGGER, H., VON JAGOW, G., Tricine-sodium dodecyl sulfate-polyacrylamide gel electrophoresis for the separation of proteins in the range from 1 to 100kDa (1987) Anal. Biochem, 166, pp. 368-379
dc.descriptionSOARES, A.M., GUERRA-SÁ, R., BORJA-OLIVEIRA, C.R., RODRIGUES, V.M., RODRIGUES-SIMIONI, L., RODRIGUES, V., FONTES, M.R.M., GIGLIO, J.R., Structural and functional characterization of BnSP-7, a Lys49 myotoxic phospholipase A2 homologue from Bothrops neuwiedi venom (2000) Arch. Biochem. Biophys, 378, pp. 201-209
dc.descriptionSTÜHMER, W., ROBERTS, W.M., ALMERS, W., The loose patch clamp (1983) Single Channel Recording, p. 123. , SAKMANN B AND NEHER E, Eds, Plenum Press, New York;
dc.descriptionTOYAMA, M.H., SOARES, A.M., WEN-HWA, L., POLIKARPOV, I., GIGLIO, J.R., MARANGONI, S., Amino acid sequence of piratoxin-II, a myotoxic lys49 phospholipase A 2 homologue from Bothrops pirajai venom (2000) Biochimie, 82, pp. 245-250
dc.descriptionTSAI, I.H., LU, P.J., WANG, Y.M., HO, C.L., LIAW, L.L., Molecular cloning and characterization of a neurotoxic phospholipase A2 from the venom of Taiwan habu (Trimeresurus mucrosquamatus) (1995) Biochem. J, 311, pp. 895-900
dc.descriptionVAN DEN BERGH, C.J., SLOTBOOM, A.J., VERHEIJ, H.M., DE HAAS, G.H., The role of aspartic acid-49 in the active site of phospholipase A2. A site-specific mutagenesis study of porcine pancreatic phospholipase A 2 and the rationale of the enzymatic activity of Lys-49 phospholipase A2 from Agkistrodon piscivorus piscivorus venom (1988) European J. Biochem, 176, pp. 353-357
dc.descriptionVAN DEENEN LL, D.H.G., The substrate specificity of phospholipases A2 (1963) Biochim. Biophys. Acta, 70, pp. 538-553
dc.descriptionVILJOEN, C.C., BOTES, D.P., KRUGER, H., Isolation and amino acid sequence of caudoxin, a presynaptic acting toxic phospholipase A2 from the venom of the horned puff adder (Bitis caudalis) (1982) Toxicon, 20, pp. 715-737
dc.descriptionZAMUNER, S.R., PRADO-FRANCESCHI, J., RODRIGUES-SIMIONI, L., The screening of Bothrops venoms for neurotoxic activity using the chick biventer cervicis preparation (1996) Toxicon, 34, pp. 314-315
dc.languageen
dc.publisher
dc.relationJournal of Venomous Animals and Toxins Including Tropical Diseases
dc.rightsaberto
dc.sourceScopus
dc.titlePurification And N-terminal Sequencing Of Two Presynaptic Neurotoxic Pla2, Neuwieditoxin-i And Neuwieditoxin-ii, From Bothrops Neuwiedi Pauloensis (jararaca Pintada) Venom
dc.typeArtículos de revistas


Este ítem pertenece a la siguiente institución