Artículos de revistas
Isolation And Characterization Of A Convulxin-like Protein From Crotalus Durissus Collilineatus Venom
Registro en:
Journal Of Protein Chemistry. , v. 20, n. 7, p. 585 - 591, 2001.
2778033
10.1023/A:1013377331569
2-s2.0-0035704759
Autor
Toyama M.H.
Carneiro E.M.
Marangoni S.
Amaral M.E.C.
Velloso L.A.
Boschero A.C.
Institución
Resumen
A convulxin (Cvx)-like protein was isolated from Crotalus durissus collilineatus venom by a combination of molecular exclusion and reversed-phase HPLC chromatographies. The molecular mass of the Cvx-like protein in the absence and presence of DTT was 78 kDa and 12-13 kDa, respectively. The Cvx-like protein consisted of two nonidentical polypeptide chains (α and β). The N-terminal amino-acid sequences of the α and β subunits were GLHCPSDWYAYDGHCYKIFNEEMNWED and GFCCPSHWSSYSRYCYKFFSQEMNWEDAEK, respectively, with both subunits having a high content of Glu, Ser, Cys, and Asp. The Cvx-like protein showed high homology with other venom C-type lectins, but had low hemagglutinating activity on intact and trypsinized erythrocytes. The Cvx-like protein stimulated insulin receptor phosphorylation and potentiated insulin secretion from isolated islets in the presence of sub- (2.8 mM) or supra-physiological (16.7 mM) glucose concentrations. These results suggest that the increase in insulin secretion induced by Cvx-like protein may be mediated by a protein tyrosine kinase-dependent pathway and may involve other membrane receptors, such as GP VI or Scr family proteins. 20 7 585 591 Aragon-Ortiz, F., Mentele, R., Auerswald, E.A., (1996) Toxicon, 34, pp. 763-769 Aspinwall, C.A., Qian, W.J., Roper, M.G., Kulkami, R.N., Kahn, C.R., Kennedy, R.T., (2000) J. Biol. Chem., 275, pp. 22331-22338 Boschero, A.C., Szpak-Glasman, M., Carneiro, E.M., Bordin, S., Paul, I., Rojas, E., Atwater, I., (1995) Am. J. Physiol., 268, pp. E336-E342 Carvalho, D.D., Marangoni, S., Oliveira, B., Novello, J.C., (1998) Biochem. Mol. Biol. Internat., 44, pp. 933-938 Cicmil, M., Thomas, J.M., Sage, T., Barry, F.A., Leduc, M., Bon, C., Gibbins, J.M., (2000) J. Biol. Chem., 275, pp. 27339-27347 Drickamer, K., (1988) J. Biol. Chem., 263, pp. 9557-9560 Francischetti, I.M., Saliou, B., Leduc, M., Carlini, C.R., Hatmi, M., Randon, J., Faili, A., Bon, C., (1997) Toxicon, 35, pp. 1217-1228 Francischetti, I.M., Carlini, C.R., Guimaräes, J.A., (1998) Biochem. Biophys., 354, pp. 255-262 Francischetti, I.M., Ghazaleh, F.A., Reis, R.A., Carlini, C.R., Guimaräes, J.A., (1998) Arch. Biochem. Biophys., 353, pp. 239-250 Henrikson, R.L., Meredith, S.C., (1984) Analyt. Biochem., 136, pp. 65-71 Hirabayashi, J., Kusunoki, T., Kasai, K., (1991) J. Biol. Chem., 266, pp. 2320-2326 Hori, K., Matsubara, K., Miyazawa, K., (2000) Biochim. Biophys. Acta, 1474, pp. 226-236 Komori, Y., Nikai, T., Tohkai, T., Sugihara, H., (1999) Toxicon, 37, pp. 1053-1064 Lennon, B.W., Kaiser, I., (1990) Comp. Biochem. Physiol. B, 97, pp. 695-699 Liener, I.E., Sharon, N., Goldstein, I.J., (1986), Academic Press, LondonMarangoni, S., Toyama, M.H., Arantes, E.C., Giglio, J.R., Da Silva, C.A., Carneiro, E.M., Gonçalves, A.A., Oliveira, B., (1995) Biochem. Biophys. Acta, 1243, pp. 309-314 Marlas, G., (1985) Biochimie, 67, pp. 1231-1239 Marlas, G., Joseph, D., Huet, C., (1983) Biochimie, 65, pp. 619-628 Matsuzaki, R., Yoshida, E., Yamada, M., Atoda, H., Morita, T., (1996) Biochem. Biophys. Res. Commun., 220, pp. 382-387 Niedergang, F., Alcover, A., Knight, C.G., Farndale, R.W., Barnes, M.J., Francischetti, I.M., Bon, C., Leduc, M., (2000) Biochem. Biophys. Res. Commun., 273, pp. 246-250 Nikai, T., Suzuki, J., Komori, Y., Ohkura, M., Ohizumi, Y., Sugihara, H., (1995) Biol. Pharm. Bull., 18, pp. 620-622 Nikai, T., Kato, S., Komori, Y., Sugihara, H., (2000) Toxicon, 38, pp. 707-711 Prado-Franceschi, J., Tavares, D.Q., Hertel, R., Lobo de Araújo, A., (1981) Toxicon, 19, pp. 661-666 Sakurai, Y., Fujimura, Y., Kokubo, T., Imamura, K., Kawasaki, T., Handa, M., Suzuki, M., Yoshioka, A., (1998) Thromb. Haemost., 79, pp. 1199-1207 Santoro, M.L., Sousa-E-Silva, M.C., Gonçalves, L.R., Almeida-Santos, S.M., Cardoso, D.F., Laporta-Ferreira, I.L., Saiki, M., Sano-Martins, I.S., (1999) Comp. Biochem. Physiol. C, 122, pp. 61-73 Schagger, H.G., Von Jagow, H.G., (1987) Anal. Biochem., 166, pp. 368-379 Shin, Y., Okuyama, I., Hasegawa, J., Morita, T., (2000) Thromb. Res., 99, pp. 239-247 Toyama, M.H., Leite, G.B., Rodrigues-Simioni, L., Saraguacy-Hemandez, O.S., Novello, J.C., Marangoni, S., (2000) Protein Pept. Lett., 7, pp. 381-388 Toyama, M.H., Soares, A.M., Novello, J.C., Oliveira, B., Giglio, J.R., Marangoni, S., (2000) Biochimie, 82, pp. 245-250 Usami, Y., Suzuki, M., Yoshida, E., Sakurai, Y., Hirano, K., Kawasaki, T., Fujimura, Y., Titani, K., (1993) Biochem. Biophys. Res. Commun., 219, pp. 727-733 Usami, Y., Fujimura, Y., Suzuki, M., Ozeki, Y., Nishio, K., Fukui, H., Titani, K., (1996) Proc. Natl. Acad. Sci. USA, 90, pp. 928-932