Artículos de revistas
Biochemical, pharmacological and structural characterization of a new PLA(2) from Crotalus durissus terrificus (South american rattlesnake) venom
Registration in:
Protein Journal. Springer, v. 24, n. 4, n. 233, n. 242, 2005.
1572-3887
WOS:000233246300005
10.1007/s10930-005-6718-z
Author
Hernandez-Oliveira, S
Toyama, MH
Toyama, DO
Marangoni, S
Hyslop, S
Rodrigues-Simioni, L
Institutions
Abstract
A new PLA(2) (F16) was purified from Crotalus durissus terrificus venom by molecular exclusion chromatography followed by analytical reverse phase HPLC. The PLA(2) (14.86 kDa by MALDI-TOF mass spectrometry) had an amino acid sequence of SLLQFNKMIKFETRKNAVPFYAFYGCYCGWGGRRRPKDATDRCCFVHDCCYEKVTKCNTKWDIYRYSLKSGYITCGKGTWCKEQICECDRVAAECLRRSLSTYKNGYMFYPDSRCRGPSETC, and showed highly conserved Ca2+-binding and catalytic sites. F16 showed allosteric behavior with 10 mM Ca2+ and had temperature and pH optima of 25 degrees C and 7.9, respectively. F16 (10 mu g/ml) produced neuromuscular blockade in chick biventer cervicis preparations in the absence and presence of crotapotin, indicating that crotapotin was not essential for neuromuscular action in this preparation. In contrast, in mouse phrenic nerve-diaphragm preparations, the neuromuscular blockade produced by the same concentration of toxin was dependent on crotapotin. Pre-incubation with heparin markedly reduced the neurotoxicity of F16. These results show that the biochemical and structural properties of F16 are similar to those of the PLA(2) isoforms F15 and F17, but that the neurotoxicity and the requirement for crotapotin to form the crotoxin complex varies according to the neuromuscular preparation. 24 4 233 242